Class a: All alpha proteins [46456] (289 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) |
Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
Protein automated matches [226872] (8 species) not a true protein |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226413] (15 PDB entries) |
Domain d4mvwa2: 4mvw A:607-767 [263059] Other proteins in same PDB: d4mvwa1, d4mvwb1, d4mvwb3 automated match to d4mvyb1 protein/RNA complex; complexed with 43e, dms, gol, met, so4 |
PDB Entry: 4mvw (more details), 2.9 Å
SCOPe Domain Sequences for d4mvwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mvwa2 a.27.1.0 (A:607-767) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst
Timeline for d4mvwa2: