Lineage for d4mpma_ (4mpm A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717763Protein Neuroglobin [100978] (2 species)
  7. 1717764Species Human (Homo sapiens) [TaxId:9606] [100979] (2 PDB entries)
  8. 1717769Domain d4mpma_: 4mpm A: [263050]
    automated match to d1oj6b_
    complexed with hem

Details for d4mpma_

PDB Entry: 4mpm (more details), 1.74 Å

PDB Description: Wild-type human neuroglobin
PDB Compounds: (A:) neuroglobin

SCOPe Domain Sequences for d4mpma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mpma_ a.1.1.2 (A:) Neuroglobin {Human (Homo sapiens) [TaxId: 9606]}
rpepelirqswravsrsplehgtvlfarlfalepdllplfqyncrqfsspedclsspefl
dhirkvmlvidaavtnvedlssleeylaslgrkhravgvklssfstvgesllymlekclg
paftpatraawsqlygavvqamsrgwd

SCOPe Domain Coordinates for d4mpma_:

Click to download the PDB-style file with coordinates for d4mpma_.
(The format of our PDB-style files is described here.)

Timeline for d4mpma_: