SCOPe 2.05: Domain d4m3kb_: 4m3k B:

Lineage for d4m3kb_ (4m3k B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (93 PDB entries)

8. Domain d4m3kb_: 4m3k B: [262999]
   Other proteins in same PDB: d4m3ka_
   automated match to d4m3ja_
   complexed with cl

Details for d4m3kb_

PDB Entry: 4m3k, 1.48 Å

PDB Description: Structure of a single domain camelid antibody fragment cAb-H7S in complex with the BlaP beta-lactamase from Bacillus licheniformis

PDB Compounds: (B:) Camelid heavy-chain antibody variable fragment cAb-H7S

SCOPe Domain Sequences for d4m3kb_:

Sequence, based on SEQRES records:

>d4m3kb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqpggslrlscaasgsissittmgwyrqdpgkgrelvalinsvgdttyag
svkgrftisrdnakntvylemsslkpedtavyycnafmstnsgrtgsfwgqgtqvtvss

Sequence, based on observed residues (ATOM records):

>d4m3kb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqpggslrlscaasgsissittmgwyrqdgrelvalinsvgdttyagsvk
grftisrdnakntvylemsslkpedtavyycnafmstnsgrtgsfwgqgtqvtvss

Timeline for d4m3kb_:

• d4m3kb_ is new in SCOPe 2.05-stable
  
• d4m3kb_ is called d4m3kb1 in SCOPe 2.06
  
• d4m3kb_ appears in the current release, SCOPe 2.08, called d4m3kb1