SCOPe 2.05: Domain d4m0xb1: 4m0x B:1-129

Lineage for d4m0xb1 (4m0x B:1-129)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Rhodococcus opacus [TaxId:37919] [257919] (1 PDB entry)

8. Domain d4m0xb1: 4m0x B:1-129 [262995]
   Other proteins in same PDB: d4m0xa2, d4m0xb2
   automated match to d4m0xa1
   complexed with cl, mn

Details for d4m0xb1

PDB Entry: 4m0x, 2.7 Å

PDB Description: Crystal structure of 2-chloromuconate cycloisomerase from Rhodococcus opacus 1CP

PDB Compounds: (B:) chloromuconate cycloisomerase

SCOPe Domain Sequences for d4m0xb1:

Sequence, based on SEQRES records:

>d4m0xb1 d.54.1.0 (B:1-129) automated matches {Rhodococcus opacus [TaxId: 37919]}
mtttitemsativdlpsrrphkfaattmhhqsivlvrvrdsdggegigeavtpggpwwgg
esvetiktiidqylapviigrdpstigvasqsmdglvfgnsvakaaietalwddrerrsr
ipvsdllgg

Sequence, based on observed residues (ATOM records):

>d4m0xb1 d.54.1.0 (B:1-129) automated matches {Rhodococcus opacus [TaxId: 37919]}
mtttitemsativdlpsrrhhqsivlvrvrdsdggegigeavtpggpwwggesvetikti
idqylapviigrdpstigvasqsmdglvfgnsvakaaietalwddrerrsripvsdllgg

Timeline for d4m0xb1:

• d4m0xb1 is new in SCOPe 2.05-stable
  
• d4m0xb1 appears in SCOPe 2.06
  
• d4m0xb1 appears in the current release, SCOPe 2.08