Lineage for d4lx4b_ (4lx4 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095828Species Pseudomonas stutzeri [TaxId:379731] [257915] (1 PDB entry)
  8. 2095830Domain d4lx4b_: 4lx4 B: [262992]
    automated match to d4lx4a_
    complexed with trs

Details for d4lx4b_

PDB Entry: 4lx4 (more details), 1.56 Å

PDB Description: crystal structure determination of pseudomonas stutzeri endoglucanase cel5a using a twinned data set
PDB Compounds: (B:) Endoglucanase(Endo-1,4-beta-glucanase)protein

SCOPe Domain Sequences for d4lx4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lx4b_ c.1.8.0 (B:) automated matches {Pseudomonas stutzeri [TaxId: 379731]}
wpvndegglalhgvnisgagfaphitpgkngthyfypekkhfkyyadqgirlirfpfiwe
rvqhsldsglnfdqirllkktldlaaqngqkvildmhnygryhgeligsskvpyeayasv
wrklaerfkghpgllgydimnephstvglwpgaaqaavdairevddqtlifiegerwssa
yhwplvnanflindpadrliyeahlyfdddfsgkymaqtsrnidpmigverarpfiewlq
khgqkgflgeygipddlpeaaqamdnllaylndncvpsaywaggpgwgtyklaieprngk
drpqmelmrkhlandctaigptpaqiad

SCOPe Domain Coordinates for d4lx4b_:

Click to download the PDB-style file with coordinates for d4lx4b_.
(The format of our PDB-style files is described here.)

Timeline for d4lx4b_: