Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (90 species) not a true protein |
Species Pseudomonas stutzeri [TaxId:379731] [257915] (1 PDB entry) |
Domain d4lx4b_: 4lx4 B: [262992] automated match to d4lx4a_ complexed with trs |
PDB Entry: 4lx4 (more details), 1.56 Å
SCOPe Domain Sequences for d4lx4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lx4b_ c.1.8.0 (B:) automated matches {Pseudomonas stutzeri [TaxId: 379731]} wpvndegglalhgvnisgagfaphitpgkngthyfypekkhfkyyadqgirlirfpfiwe rvqhsldsglnfdqirllkktldlaaqngqkvildmhnygryhgeligsskvpyeayasv wrklaerfkghpgllgydimnephstvglwpgaaqaavdairevddqtlifiegerwssa yhwplvnanflindpadrliyeahlyfdddfsgkymaqtsrnidpmigverarpfiewlq khgqkgflgeygipddlpeaaqamdnllaylndncvpsaywaggpgwgtyklaieprngk drpqmelmrkhlandctaigptpaqiad
Timeline for d4lx4b_: