Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d4ltcv_: 4ltc V: [262984] Other proteins in same PDB: d4ltca_, d4ltcc2, d4ltce_, d4ltcf_, d4ltcg_, d4ltci_, d4ltcj_, d4ltck_, d4ltcl_, d4ltcm_, d4ltcn_, d4ltco_, d4ltcq2, d4ltcs_, d4ltct_, d4ltcu_, d4ltcw_, d4ltcx_, d4ltcy_, d4ltcz_ automated match to d4r17h_ complexed with ec6 |
PDB Entry: 4ltc (more details), 2.5 Å
SCOPe Domain Sequences for d4ltcv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ltcv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
Timeline for d4ltcv_:
View in 3D Domains from other chains: (mouse over for more information) d4ltca_, d4ltcb_, d4ltcc1, d4ltcc2, d4ltcd_, d4ltce_, d4ltcf_, d4ltcg_, d4ltch_, d4ltci_, d4ltcj_, d4ltck_, d4ltcl_, d4ltcm_, d4ltcn_, d4ltco_, d4ltcp_, d4ltcq1, d4ltcq2, d4ltcr_, d4ltcs_, d4ltct_, d4ltcu_, d4ltcw_, d4ltcx_, d4ltcy_, d4ltcz_ |