Lineage for d4ltct_ (4ltc T:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230621Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2230635Domain d4ltct_: 4ltc T: [262983]
    Other proteins in same PDB: d4ltca_, d4ltcb_, d4ltcc_, d4ltcd_, d4ltce_, d4ltcg_, d4ltch_, d4ltci_, d4ltcj_, d4ltck_, d4ltcl_, d4ltcm_, d4ltcn_, d4ltco_, d4ltcp_, d4ltcq_, d4ltcr_, d4ltcs_, d4ltcu_, d4ltcv_, d4ltcw_, d4ltcx_, d4ltcy_, d4ltcz_
    automated match to d1irug_
    complexed with ec6

Details for d4ltct_

PDB Entry: 4ltc (more details), 2.5 Å

PDB Description: Crystal structure of yeast 20S proteasome in complex with enone carmaphycin analogue 6
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4ltct_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ltct_ d.153.1.0 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

SCOPe Domain Coordinates for d4ltct_:

Click to download the PDB-style file with coordinates for d4ltct_.
(The format of our PDB-style files is described here.)

Timeline for d4ltct_: