Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily) not a true fold |
Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (4 families) not a true superfamily |
Family d.184.1.0: automated matches [257038] (1 protein) not a true family |
Protein automated matches [257039] (1 species) not a true protein |
Species Chroomonas sp. [TaxId:3029] [257040] (1 PDB entry) |
Domain d4lmsa_: 4lms A: [262959] Other proteins in same PDB: d4lmsb_, d4lmsd_ automated match to d4lmsc_ complexed with cyc, dbv, m1v, p6g |
PDB Entry: 4lms (more details), 1.35 Å
SCOPe Domain Sequences for d4lmsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lmsa_ d.184.1.0 (A:) automated matches {Chroomonas sp. [TaxId: 3029]} rdaqlrapiveifdargcdaknaqytgpksndmnddqcvkvsmqkitvseataakklqef iggkatainvpiissmtkky
Timeline for d4lmsa_: