SCOPe 2.05: Domain d4lllm_: 4lll M:

Lineage for d4lllm_ (4lll M:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (57 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [193082] (6 PDB entries)

8. Domain d4lllm_: 4lll M: [262957]
   automated match to d4llla_
   protein/DNA complex

Details for d4lllm_

PDB Entry: 4lll, 3.04 Å

PDB Description: crystal structure of s. aureus mepr-dna complex

PDB Compounds: (M:) MepR

SCOPe Domain Sequences for d4lllm_:

Sequence, based on SEQRES records:

>d4lllm_ a.4.5.0 (M:) automated matches {Staphylococcus aureus [TaxId: 1280]}
sylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtgptvs
nllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlseeene
qmkanltkmlsslq

Sequence, based on observed residues (ATOM records):

>d4lllm_ a.4.5.0 (M:) automated matches {Staphylococcus aureus [TaxId: 1280]}
sylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtgptvs
nllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqteqmkanltkml
sslq

Timeline for d4lllm_:

• d4lllm_ is new in SCOPe 2.05-stable
  
• d4lllm_ appears in SCOPe 2.06
  
• d4lllm_ appears in the current release, SCOPe 2.08