Lineage for d4llld_ (4lll D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2695060Species Staphylococcus aureus [TaxId:1280] [193082] (9 PDB entries)
  8. 2695086Domain d4llld_: 4lll D: [262954]
    automated match to d4llla_
    protein/DNA complex

Details for d4llld_

PDB Entry: 4lll (more details), 3.04 Å

PDB Description: crystal structure of s. aureus mepr-dna complex
PDB Compounds: (D:) MepR

SCOPe Domain Sequences for d4llld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4llld_ a.4.5.0 (D:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtgp
tvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlsee
eneqmkanltkmlsslq

SCOPe Domain Coordinates for d4llld_:

Click to download the PDB-style file with coordinates for d4llld_.
(The format of our PDB-style files is described here.)

Timeline for d4llld_: