Lineage for d4kugd1 (4kug D:1-183)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846566Species Clostridium butyricum [TaxId:632245] [256900] (4 PDB entries)
  8. 2846578Domain d4kugd1: 4kug D:1-183 [262860]
    Other proteins in same PDB: d4kuga2, d4kugb2, d4kugc2, d4kugd2
    automated match to d3hada2
    complexed with nad

Details for d4kugd1

PDB Entry: 4kug (more details), 2.3 Å

PDB Description: crystal structure of 3-hydroxybutylryl-coa dehydrogenase with nad from clostridium butyricum
PDB Compounds: (D:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d4kugd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kugd1 c.2.1.0 (D:1-183) automated matches {Clostridium butyricum [TaxId: 632245]}
mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
eap

SCOPe Domain Coordinates for d4kugd1:

Click to download the PDB-style file with coordinates for d4kugd1.
(The format of our PDB-style files is described here.)

Timeline for d4kugd1: