SCOPe 2.05: Domain d4kugc1: 4kug C:1-183

Lineage for d4kugc1 (4kug C:1-183)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Clostridium butyricum [TaxId:632245] [256900] (4 PDB entries)

8. Domain d4kugc1: 4kug C:1-183 [262858]
   Other proteins in same PDB: d4kuga2, d4kugb2, d4kugc2, d4kugd2
   automated match to d3hada2
   complexed with nad

Details for d4kugc1

PDB Entry: 4kug, 2.3 Å

PDB Description: crystal structure of 3-hydroxybutylryl-coa dehydrogenase with nad from clostridium butyricum

PDB Compounds: (C:) 3-hydroxybutyryl-CoA dehydrogenase

SCOPe Domain Sequences for d4kugc1:

Sequence; same for both SEQRES and ATOM records:

>d4kugc1 c.2.1.0 (C:1-183) automated matches {Clostridium butyricum [TaxId: 632245]}
mkkvfvlgagtmgagivqafaakgcevivrdikeefvdrgiatitkslsklvakekitea
dkeeilsrisgttdmklaadcdlvveaaienmkikkeifaeldgickpetilasntssls
itevasatkradkvigmhffnpapvmklvevirgaatsqetfdavkemsesigktpveva
eap

Timeline for d4kugc1:

• d4kugc1 is new in SCOPe 2.05-stable
  
• d4kugc1 appears in SCOPe 2.06
  
• d4kugc1 appears in the current release, SCOPe 2.08