Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) contains one classic and one pseudo HhH motifs |
Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins) topological similarity to the N-terminal domain automatically mapped to Pfam PF10391 |
Protein DNA polymerase lambda [101253] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101254] (27 PDB entries) |
Domain d4k4gi2: 4k4g I:329-385 [262795] Other proteins in same PDB: d4k4ga1, d4k4ga3, d4k4ga4, d4k4ge1, d4k4ge3, d4k4ge4, d4k4gi1, d4k4gi3, d4k4gi4, d4k4gm1, d4k4gm3, d4k4gm4 automated match to d2bcqa2 protein/DNA complex; complexed with 1s0, act, ca, cac |
PDB Entry: 4k4g (more details), 2.15 Å
SCOPe Domain Sequences for d4k4gi2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k4gi2 a.60.12.1 (I:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle
Timeline for d4k4gi2: