Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (29 species) not a true protein |
Species Influenza A virus [TaxId:393616] [267957] (1 PDB entry) |
Domain d4julf_: 4jul F: [262772] Other proteins in same PDB: d4jula1, d4jula2, d4julc1, d4julc2, d4jule1, d4jule2, d4julh1, d4julh2, d4julj1, d4julj2, d4jull_ automated match to d3gbmb_ complexed with nag |
PDB Entry: 4jul (more details), 2.79 Å
SCOPe Domain Sequences for d4julf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4julf_ h.3.1.1 (F:) automated matches {Influenza A virus [TaxId: 393616]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkree
Timeline for d4julf_: