Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (72 species) not a true protein |
Species Clostridium perfringens [TaxId:195102] [267956] (2 PDB entries) |
Domain d4jkma3: 4jkm A:276-599 [262759] Other proteins in same PDB: d4jkma1, d4jkma2, d4jkmb1, d4jkmb2, d4jkmd_ automated match to d3hn3a3 |
PDB Entry: 4jkm (more details), 2.26 Å
SCOPe Domain Sequences for d4jkma3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jkma3 c.1.8.0 (A:276-599) automated matches {Clostridium perfringens [TaxId: 195102]} vevkdgkflinnkpfyfkgfgkhedsyvngrgineainikdfnlmkwigansfrtshypy seeimrladregivvidetpavglhlnfmatgfggdapkrdtwkeigtkeaherilrelv srdknhpcvvmwsvanepdsdsegakeyfeplikltkeldpqkrpvtvvtylmstpdrck vgdivdvlclnryygwyvaggdleeakrmledelkgweercpktpimfteygadtvaglh dtvpvmfteeyqveyykanhevmdkcknfvgeqvwnfadfatsqgiirvqgnkkgiftre rkpkmiahslrerwtnipefgykk
Timeline for d4jkma3:
View in 3D Domains from other chains: (mouse over for more information) d4jkmb1, d4jkmb2, d4jkmb3, d4jkmd_ |