Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (31 species) not a true protein |
Species Clostridium perfringens [TaxId:195102] [267954] (2 PDB entries) |
Domain d4jkma1: 4jkm A:-2-182 [262757] Other proteins in same PDB: d4jkma2, d4jkma3, d4jkmb2, d4jkmb3, d4jkmd_ automated match to d3hn3a1 |
PDB Entry: 4jkm (more details), 2.26 Å
SCOPe Domain Sequences for d4jkma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jkma1 b.18.1.0 (A:-2-182) automated matches {Clostridium perfringens [TaxId: 195102]} snamlypiitesrqlidlsgiwkfklnegnglteelskapledtiemavpssyndlvesq evrdhvgwvwyernftipktllnerivlrfgsatheakvylngellvehkggftpfeaei ndllvsgdnrltvavnniidettlpvglvkevevdgkkviknsvnfdffnyagihrpvki yttpk
Timeline for d4jkma1:
View in 3D Domains from other chains: (mouse over for more information) d4jkmb1, d4jkmb2, d4jkmb3, d4jkmd_ |