Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.0: automated matches [191672] (1 protein) not a true family |
Protein automated matches [191281] (13 species) not a true protein |
Species Pseudomonas putida [TaxId:160488] [259652] (2 PDB entries) |
Domain d4j25g_: 4j25 G: [262741] Other proteins in same PDB: d4j25a2, d4j25b2, d4j25c2, d4j25d2 automated match to d4j25a_ complexed with mn, oga |
PDB Entry: 4j25 (more details), 1.97 Å
SCOPe Domain Sequences for d4j25g_:
Sequence, based on SEQRES records: (download)
>d4j25g_ b.82.2.0 (G:) automated matches {Pseudomonas putida [TaxId: 160488]} mlaavvddlathgwsqqahflpadlvralaaecrrrdaegelnpagvgrgatqevretir gdqiqwidpgqaeacdqylaamdqlrlainqglflgledfechfalyppgafyrrhldrf rdddrrmvsavlylnegwqphdggqlrmfladgvehdvepvagclvvflsgevphevlpa grerlsltgwfrrrg
>d4j25g_ b.82.2.0 (G:) automated matches {Pseudomonas putida [TaxId: 160488]} mlaavvddlathgwsqqahflpadlvralaaecrrrdaeelnparetirgdqiqwidpgq aeacdqylaamdqlrlainqglflgledfechfalyppgafyrrhldrfrdddrrmvsav lylnegwqphdggqlrmfladgvehdvepvagclvvflsgevphevlpagrerlsltgwf rrrg
Timeline for d4j25g_: