Lineage for d4j25e_ (4j25 E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2081124Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2081914Family b.82.2.0: automated matches [191672] (1 protein)
    not a true family
  6. 2081915Protein automated matches [191281] (13 species)
    not a true protein
  7. 2081986Species Pseudomonas putida [TaxId:160488] [259652] (2 PDB entries)
  8. 2081991Domain d4j25e_: 4j25 E: [262739]
    Other proteins in same PDB: d4j25a2, d4j25b2, d4j25c2, d4j25d2
    automated match to d4j25a_
    complexed with mn, oga

Details for d4j25e_

PDB Entry: 4j25 (more details), 1.97 Å

PDB Description: Crystal structure of a Pseudomonas putida prolyl-4-hydroxylase (P4H)
PDB Compounds: (E:) Putative uncharacterized protein

SCOPe Domain Sequences for d4j25e_:

Sequence, based on SEQRES records: (download)

>d4j25e_ b.82.2.0 (E:) automated matches {Pseudomonas putida [TaxId: 160488]}
mlaavvddlathgwsqqahflpadlvralaaecrrrdaegelnpagvgrgatqevretir
gdqiqwidpgqaeacdqylaamdqlrlainqglflgledfechfalyppgafyrrhldrf
rdddrrmvsavlylnegwqphdggqlrmfladgvehdvepvagclvvflsgevphevlpa
grerlsltgwfrrrg

Sequence, based on observed residues (ATOM records): (download)

>d4j25e_ b.82.2.0 (E:) automated matches {Pseudomonas putida [TaxId: 160488]}
mlaavvddlathgwsqqahflpadlvralaaecrrrdaegelnpaetirgdqiqwidpgq
aeacdqylaamdqlrlainqglflgledfechfalyppgafyrrhldrfrdddrrmvsav
lylnegwqphdggqlrmfladgvehdvepvagclvvflsgevphevlpagrerlsltgwf
rrrg

SCOPe Domain Coordinates for d4j25e_:

Click to download the PDB-style file with coordinates for d4j25e_.
(The format of our PDB-style files is described here.)

Timeline for d4j25e_: