SCOPe 2.08: Domain d4j25c1: 4j25 C:2-202

Lineage for d4j25c1 (4j25 C:2-202)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.0: automated matches [191672] (1 protein)
   not a true family

6. Protein automated matches [191281] (21 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:160488] [259652] (2 PDB entries)

8. Domain d4j25c1: 4j25 C:2-202 [262737]
   Other proteins in same PDB: d4j25a2, d4j25b2, d4j25c2, d4j25d2
   automated match to d4j25a_
   complexed with mn, oga

Details for d4j25c1

PDB Entry: 4j25, 1.97 Å

PDB Description: Crystal structure of a Pseudomonas putida prolyl-4-hydroxylase (P4H)

PDB Compounds: (C:) Putative uncharacterized protein

SCOPe Domain Sequences for d4j25c1:

Sequence, based on SEQRES records:

>d4j25c1 b.82.2.0 (C:2-202) automated matches {Pseudomonas putida [TaxId: 160488]}
hispehpmlaavvddlathgwsqqahflpadlvralaaecrrrdaegelnpagvgrgatq
evretirgdqiqwidpgqaeacdqylaamdqlrlainqglflgledfechfalyppgafy
rrhldrfrdddrrmvsavlylnegwqphdggqlrmfladgvehdvepvagclvvflsgev
phevlpagrerlsltgwfrrr

Sequence, based on observed residues (ATOM records):

>d4j25c1 b.82.2.0 (C:2-202) automated matches {Pseudomonas putida [TaxId: 160488]}
hispehpmlaavvddlathgwsqqahflpadlvralaaecrrrdaegelwidpgqaeacd
qylaamdqlrlainqglflgledfechfalyppgafyrrhldrfrdddrrmvsavlylne
gwqphdggqlrmfladgvehdvepvagclvvflsgevphevlpagrerlsltgwfrrr

Timeline for d4j25c1:

• d4j25c1 first appeared in SCOPe 2.05, called d4j25c_
  
• d4j25c1 appears in SCOPe 2.07