SCOP 1.71: Domain d1flee_: 1fle E:

Lineage for d1flee_ (1fle E:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (59 PDB entries)

8. Domain d1flee_: 1fle E: [26271]
   Other proteins in same PDB: d1flei_

Details for d1flee_

PDB Entry: 1fle, 1.9 Å

PDB Description: crystal structure of elafin complexed with porcine pancreatic elastase

SCOP Domain Sequences for d1flee_:

Sequence; same for both SEQRES and ATOM records:

>d1flee_ b.47.1.2 (E:) Elastase {Pig (Sus scrofa)}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d1flee_:

• d1flee_ first appeared (with stable ids) in SCOP 1.55
  
• d1flee_ appears in SCOP 1.69
  
• d1flee_ appears in SCOP 1.73
  
• d1flee_ appears in the current release, SCOPe 2.08