Lineage for d1flee_ (1fle E:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15030Protein Elastase [50536] (3 species)
  7. 15036Species Pig (Sus scrofa) [TaxId:9823] [50538] (42 PDB entries)
  8. 15071Domain d1flee_: 1fle E: [26271]
    Other proteins in same PDB: d1flei_

Details for d1flee_

PDB Entry: 1fle (more details), 1.9 Å

PDB Description: crystal structure of elafin complexed with porcine pancreatic elastase

SCOP Domain Sequences for d1flee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flee_ b.47.1.2 (E:) Elastase {Pig (Sus scrofa)}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOP Domain Coordinates for d1flee_:

Click to download the PDB-style file with coordinates for d1flee_.
(The format of our PDB-style files is described here.)

Timeline for d1flee_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1flei_