SCOPe 2.06: Domain d4grwi_: 4grw I:

Lineage for d4grwi_ (4grw I:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama glama [TaxId:9844] [236993] (1 PDB entry)

8. Domain d4grwi_: 4grw I: [262706]
   automated match to d4grwh_

Details for d4grwi_

PDB Entry: 4grw, 2.55 Å

PDB Description: structure of a complex of human il-23 with 3 nanobodies (llama vhhs)

PDB Compounds: (I:) Nanobody 22E11

SCOPe Domain Sequences for d4grwi_:

Sequence; same for both SEQRES and ATOM records:

>d4grwi_ b.1.1.1 (I:) automated matches {Llama glama [TaxId: 9844]}
evqlvesggglvqaggslrlscaasgrtfswsavgwfrqapgkerefvaairwsggspyy
adsvkdrftisrdnakntvylqmnslrpedtavylcgetslfptsrgshydtwgqgtqvt
vss

Timeline for d4grwi_:

• d4grwi_ first appeared in SCOPe 2.05
  
• d4grwi_ appears in SCOPe 2.07
  
• d4grwi_ appears in the current release, SCOPe 2.08