SCOPe 2.08: Domain d4eg1a1: 4eg1 A:239-606

Lineage for d4eg1a1 (4eg1 A:239-606)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (61 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:999953] [226467] (29 PDB entries)

8. Domain d4eg1a1: 4eg1 A:239-606 [262694]
   Other proteins in same PDB: d4eg1a2, d4eg1b2, d4eg1b3
   automated match to d4mvyb2
   protein/RNA complex; complexed with gol, met

Details for d4eg1a1

PDB Entry: 4eg1, 2.9 Å

PDB Description: trypanosoma brucei methionyl-trna synthetase in complex with substrate methionine

PDB Compounds: (A:) Methionyl-tRNA synthetase, putative

SCOPe Domain Sequences for d4eg1a1:

Sequence; same for both SEQRES and ATOM records:

>d4eg1a1 c.26.1.0 (A:239-606) automated matches {Trypanosoma brucei [TaxId: 999953]}
ekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaeaak
qkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiylgr
yegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerlle
wyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwldal
tnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglpl
pkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdknm
iarlngel

Timeline for d4eg1a1:

• d4eg1a1 first appeared in SCOPe 2.05
  
• d4eg1a1 appears in SCOPe 2.07