Lineage for d4cyzd_ (4cyz D:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2592030Protein automated matches [254646] (28 species)
    not a true protein
  7. 2592060Species Influenza A virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256742] (3 PDB entries)
  8. 2592065Domain d4cyzd_: 4cyz D: [262669]
    Other proteins in same PDB: d4cyza_, d4cyzc_, d4cyze_
    automated match to d4cywf_
    complexed with edo, nag

Details for d4cyzd_

PDB Entry: 4cyz (more details), 2.4 Å

PDB Description: Structure of the A_mallard_Sweden_51_2002 H10 Avian Haemmaglutinin in complex with avian receptor analog LSTA
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d4cyzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cyzd_ h.3.1.1 (D:) automated matches {Influenza A virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

SCOPe Domain Coordinates for d4cyzd_:

Click to download the PDB-style file with coordinates for d4cyzd_.
(The format of our PDB-style files is described here.)

Timeline for d4cyzd_: