Lineage for d4cs5c1 (4cs5 C:1-126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977231Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2977232Protein automated matches [226907] (28 species)
    not a true protein
  7. 2977415Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [256684] (1 PDB entry)
  8. 2977420Domain d4cs5c1: 4cs5 C:1-126 [262628]
    automated match to d1plqa1

Details for d4cs5c1

PDB Entry: 4cs5 (more details), 3 Å

PDB Description: Crystal Structure of PCNA from Litopenaeus vannamei
PDB Compounds: (C:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d4cs5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cs5c1 d.131.1.0 (C:1-126) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
mfearlvqgsllkkvleaikdllneaswdcadsgiqlqamdnshvslvslnlrakgfdky
rcdrnlimgmnltsmskilkcaanddiitmkaqdnadtvtfmfespnqekvsdyemklmn
ldqehl

SCOPe Domain Coordinates for d4cs5c1:

Click to download the PDB-style file with coordinates for d4cs5c1.
(The format of our PDB-style files is described here.)

Timeline for d4cs5c1: