SCOPe 2.05: Domain d4cqve_: 4cqv E:

Lineage for d4cqve_ (4cqv E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (24 species)
   not a true protein

7. Species Influenza a virus (a/turkey/turkey/1/2005(h5n1)) [TaxId:375457] [256675] (4 PDB entries)

8. Domain d4cqve_: 4cqv E: [262625]
   Other proteins in same PDB: d4cqvb_, d4cqvd_, d4cqvf_
   automated match to d1rd8a_
   complexed with nag, po4; mutant

Details for d4cqve_

PDB Entry: 4cqv, 2.86 Å

PDB Description: crystal structure of h5 (tyty) del133/ile155thr mutant haemagglutinin

PDB Compounds: (E:) haemagglutinin ha1

SCOPe Domain Sequences for d4cqve_:

Sequence; same for both SEQRES and ATOM records:

>d4cqve_ b.19.1.2 (E:) automated matches {Influenza a virus (a/turkey/turkey/1/2005(h5n1)) [TaxId: 375457]}
dpdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsva
gwllgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqiip
ksswsdheasgvssacpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwgih
hpndaaeqtrlyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndai
nfesngnfiapenaykivkkgdstimkseleygncntkcqtpigainssmpfhnihplti
gecpkyvkssrlvlatglrnsp

Timeline for d4cqve_:

• d4cqve_ is new in SCOPe 2.05-stable
  
• d4cqve_ is called d4cqve1 in SCOPe 2.06
  
• d4cqve_ appears in the current release, SCOPe 2.08, called d4cqve1