SCOPe 2.03: Domain d1elde_: 1eld E:

Lineage for d1elde_ (1eld E:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (116 PDB entries)

8. Domain d1elde_: 1eld E: [26261]
   complexed with 0z0, acy, ca

Details for d1elde_

PDB Entry: 1eld, 2 Å

PDB Description: Structural analysis of the active site of porcine pancreatic elastase based on the x-ray crystal structures of complexes with trifluoroacetyl-dipeptide-anilide inhibitors

PDB Compounds: (E:) elastase

SCOPe Domain Sequences for d1elde_:

Sequence; same for both SEQRES and ATOM records:

>d1elde_ b.47.1.2 (E:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d1elde_:

• d1elde_ first appeared (with stable ids) in SCOP 1.55
  
• d1elde_ appears in SCOPe 2.02
  
• d1elde_ appears in SCOPe 2.04
  
• d1elde_ appears in the current release, SCOPe 2.08