SCOPe 2.06: Domain d4cpka2: 4cpk A:139-327

Lineage for d4cpka2 (4cpk A:139-327)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.0: automated matches [227232] (1 protein)
   not a true family

6. Protein automated matches [226981] (10 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [256156] (4 PDB entries)

8. Domain d4cpka2: 4cpk A:139-327 [262607]
   Other proteins in same PDB: d4cpka1, d4cpka3, d4cpkb1, d4cpkb3
   automated match to d1vqqa2
   complexed with cd, cl, mur; mutant

Details for d4cpka2

PDB Entry: 4cpk, 2.35 Å

PDB Description: crystal structure of pbp2a double clinical mutant n146k-e150k from mrsa

PDB Compounds: (A:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d4cpka2:

Sequence; same for both SEQRES and ATOM records:

>d4cpka2 d.175.1.0 (A:139-327) automated matches {Staphylococcus aureus [TaxId: 158878]}
dqsihieklkskrgkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

Timeline for d4cpka2:

• d4cpka2 first appeared in SCOPe 2.05
  
• d4cpka2 appears in SCOPe 2.07
  
• d4cpka2 appears in the current release, SCOPe 2.08