SCOPe 2.06: Domain d4cocc_: 4coc C:

Lineage for d4cocc_ (4coc C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)

6. Protein automated matches [226861] (4 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [224990] (6 PDB entries)

8. Domain d4cocc_: 4coc C: [262604]
   automated match to d2xt1a_
   complexed with so4; mutant

Details for d4cocc_

PDB Entry: 4coc, 1.59 Å

PDB Description: HIV-1 capsid C-terminal domain mutant (Y169L)

PDB Compounds: (C:) capsid protein p24

SCOPe Domain Sequences for d4cocc_:

Sequence; same for both SEQRES and ATOM records:

>d4cocc_ a.28.3.1 (C:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrflktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacqgv

Timeline for d4cocc_:

• d4cocc_ first appeared in SCOPe 2.05
  
• d4cocc_ appears in SCOPe 2.07
  
• d4cocc_ appears in the current release, SCOPe 2.08