Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries) |
Domain d4bl5g1: 4bl5 G:8-320 [262523] Other proteins in same PDB: d4bl5a2, d4bl5b2, d4bl5c2, d4bl5d2, d4bl5e2, d4bl5g2, d4bl5h2, d4bl5i2, d4bl5l2 automated match to d4bkpc_ complexed with edo, gfb, nap |
PDB Entry: 4bl5 (more details), 2.6 Å
SCOPe Domain Sequences for d4bl5g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bl5g1 c.2.1.0 (G:8-320) automated matches {Human (Homo sapiens) [TaxId: 9606]} mrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfekvqpthvi hlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpdkttypid etmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnfniedghv lpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepiilsvgee devsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftpfkqavke tcawftdnyeqar
Timeline for d4bl5g1: