Lineage for d4bgvb1 (4bgv B:2-150)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2108383Species Picrophilus torridus [TaxId:82076] [256540] (1 PDB entry)
  8. 2108385Domain d4bgvb1: 4bgv B:2-150 [262510]
    Other proteins in same PDB: d4bgva2, d4bgvb2, d4bgvc2, d4bgvd2
    automated match to d4bgva1
    complexed with cit, peg, pg6

Details for d4bgvb1

PDB Entry: 4bgv (more details), 1.81 Å

PDB Description: 1.8 a resolution structure of the malate dehydrogenase from picrophilus torridus in its apo form
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d4bgvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bgvb1 c.2.1.0 (B:2-150) automated matches {Picrophilus torridus [TaxId: 82076]}
arskisvigagavgatvaqtlairqtgdiyifdivdglaegkaldilegaphwgydldik
gfctadeskyaemkgsdvivvtaglarkpgmsrddlllknigimksvgeaikkyspeski
vvvtnpadimayaiykasgisperiiglg

SCOPe Domain Coordinates for d4bgvb1:

Click to download the PDB-style file with coordinates for d4bgvb1.
(The format of our PDB-style files is described here.)

Timeline for d4bgvb1: