Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Picrophilus torridus [TaxId:82076] [256540] (1 PDB entry) |
Domain d4bgvb1: 4bgv B:2-150 [262510] Other proteins in same PDB: d4bgva2, d4bgvb2, d4bgvc2, d4bgvd2 automated match to d4bgva1 complexed with cit, peg, pg6 |
PDB Entry: 4bgv (more details), 1.81 Å
SCOPe Domain Sequences for d4bgvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bgvb1 c.2.1.0 (B:2-150) automated matches {Picrophilus torridus [TaxId: 82076]} arskisvigagavgatvaqtlairqtgdiyifdivdglaegkaldilegaphwgydldik gfctadeskyaemkgsdvivvtaglarkpgmsrddlllknigimksvgeaikkyspeski vvvtnpadimayaiykasgisperiiglg
Timeline for d4bgvb1: