Lineage for d4a6ya1 (4a6y A:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745122Domain d4a6ya1: 4a6y A:1-112 [262507]
    Other proteins in same PDB: d4a6ya2, d4a6yl2
    automated match to d1jnha1

Details for d4a6ya1

PDB Entry: 4a6y (more details), 2.9 Å

PDB Description: crystal structure of fab fragment of anti-(4-hydroxy-3-nitrophenyl) -acetyl murine germline antibody bbe6.12h3
PDB Compounds: (A:) antibody bbe6.12h3 light chain

SCOPe Domain Sequences for d4a6ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a6ya1 b.1.1.1 (A:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtgltvlgqp

SCOPe Domain Coordinates for d4a6ya1:

Click to download the PDB-style file with coordinates for d4a6ya1.
(The format of our PDB-style files is described here.)

Timeline for d4a6ya1: