Lineage for d3wxrm_ (3wxr M:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1936658Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries)
  8. 1936828Domain d3wxrm_: 3wxr M: [262490]
    Other proteins in same PDB: d3wxrb_, d3wxrf_, d3wxrj_, d3wxrp_, d3wxrt_, d3wxrx_
    automated match to d4j70l_
    mutant

Details for d3wxrm_

PDB Entry: 3wxr (more details), 3.15 Å

PDB Description: Yeast 20S proteasome with a mutation of alpha7 subunit
PDB Compounds: (M:) Proteasome subunit beta type-6

SCOPe Domain Sequences for d3wxrm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wxrm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

SCOPe Domain Coordinates for d3wxrm_:

Click to download the PDB-style file with coordinates for d3wxrm_.
(The format of our PDB-style files is described here.)

Timeline for d3wxrm_: