Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (19 species) not a true protein |
Species Aeropyrum pernix [TaxId:56636] [255747] (1 PDB entry) |
Domain d3wxmc2: 3wxm C:228-322 [262482] Other proteins in same PDB: d3wxma1, d3wxma3, d3wxmc1, d3wxmc3, d3wxme1, d3wxme3, d3wxmg1, d3wxmg3 protein/RNA complex; complexed with gtp, mg |
PDB Entry: 3wxm (more details), 2.3 Å
SCOPe Domain Sequences for d3wxmc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wxmc2 b.43.3.0 (C:228-322) automated matches {Aeropyrum pernix [TaxId: 56636]} pvdkplripvqnvysipgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlq qaepgdnigfavrgvsksdikrgdvaghldkpptv
Timeline for d3wxmc2: