Lineage for d3wu2x_ (3wu2 X:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958580Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) (S)
    Pfam PF06596
  5. 1958581Family f.23.40.1: PsbX-like [267615] (2 proteins)
  6. 1958585Protein automated matches [267680] (1 species)
    not a true protein
  7. 1958586Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (4 PDB entries)
  8. 1958588Domain d3wu2x_: 3wu2 X: [262471]
    Other proteins in same PDB: d3wu2a_, d3wu2b_, d3wu2c_, d3wu2d_, d3wu2e_, d3wu2f_, d3wu2h_, d3wu2i_, d3wu2j_, d3wu2k_, d3wu2l_, d3wu2m_, d3wu2o_, d3wu2t_, d3wu2u_, d3wu2v_, d3wu2z_
    automated match to d3a0hx_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, so4, sqd, unl

Details for d3wu2x_

PDB Entry: 3wu2 (more details), 1.9 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (X:) Photosystem II reaction center protein X

SCOPe Domain Sequences for d3wu2x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wu2x_ f.23.40.1 (X:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqidkvqr

SCOPe Domain Coordinates for d3wu2x_:

Click to download the PDB-style file with coordinates for d3wu2x_.
(The format of our PDB-style files is described here.)

Timeline for d3wu2x_: