Lineage for d3wtuf_ (3wtu F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377721Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2378144Family b.2.5.6: RUNT domain [81318] (2 proteins)
    automatically mapped to Pfam PF00853
  6. 2378145Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
    synonym: core binding factor alpha, cbfa
  7. 2378159Species Mouse (Mus musculus) [TaxId:10090] [63684] (14 PDB entries)
    almost identical sequence to the human protein
  8. 2378176Domain d3wtuf_: 3wtu F: [262463]
    Other proteins in same PDB: d3wtub_, d3wtuc_, d3wtug_
    automated match to d1hjbc_
    protein/DNA complex

Details for d3wtuf_

PDB Entry: 3wtu (more details), 2.7 Å

PDB Description: crystal structure of the complex comprised of ets1 (v170a), runx1, cbfbeta, and the tcralpha gene enhancer dna
PDB Compounds: (F:) runt-related transcription factor 1

SCOPe Domain Sequences for d3wtuf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wtuf_ b.2.5.6 (F:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Mouse (Mus musculus) [TaxId: 10090]}
gelvrtdspnflcsvlpthwrcnktlpiafkvvakgdvpdgtlvtvmagndenysaelrn
ataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitadgprepr

SCOPe Domain Coordinates for d3wtuf_:

Click to download the PDB-style file with coordinates for d3wtuf_.
(The format of our PDB-style files is described here.)

Timeline for d3wtuf_: