Lineage for d3wswd2 (3wsw D:148-314)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2233134Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2233135Protein automated matches [226850] (29 species)
    not a true protein
  7. 2233224Species Enterococcus mundtii [TaxId:53346] [259612] (2 PDB entries)
  8. 2233228Domain d3wswd2: 3wsw D:148-314 [262458]
    Other proteins in same PDB: d3wswa1, d3wswa3, d3wswb1, d3wswb3, d3wswc1, d3wswc3, d3wswd1, d3wswd3
    automated match to d3wsva2
    complexed with fbp, gol, nad

Details for d3wswd2

PDB Entry: 3wsw (more details), 2.3 Å

PDB Description: crystal structure of minor l-lactate dehydrogenase from enterococcus mundtii in the ligands-bound form
PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3wswd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wswd2 d.162.1.0 (D:148-314) automated matches {Enterococcus mundtii [TaxId: 53346]}
ttldttrfrkeialklavdprsvhgyilgehgdsevaawshttvggkpimeyvekdhrle
endltvladkvknaayeiidrkkatyygigmsttrivkailnneqavlpvsaylngeyge
ediftgvpsivdengvreiidlsitpqekamfhqsvselkavldtvr

SCOPe Domain Coordinates for d3wswd2:

Click to download the PDB-style file with coordinates for d3wswd2.
(The format of our PDB-style files is described here.)

Timeline for d3wswd2: