Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (26 species) not a true protein |
Species Enterococcus mundtii [TaxId:53346] [259612] (2 PDB entries) |
Domain d3wswc2: 3wsw C:148-316 [262456] Other proteins in same PDB: d3wswa1, d3wswb1, d3wswc1, d3wswd1 automated match to d3wsva2 complexed with fbp, gol, nad |
PDB Entry: 3wsw (more details), 2.3 Å
SCOPe Domain Sequences for d3wswc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wswc2 d.162.1.0 (C:148-316) automated matches {Enterococcus mundtii [TaxId: 53346]} ttldttrfrkeialklavdprsvhgyilgehgdsevaawshttvggkpimeyvekdhrle endltvladkvknaayeiidrkkatyygigmsttrivkailnneqavlpvsaylngeyge ediftgvpsivdengvreiidlsitpqekamfhqsvselkavldtvrle
Timeline for d3wswc2: