Lineage for d3wsvd1 (3wsv D:3-147)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107564Species Enterococcus mundtii [TaxId:53346] [259610] (2 PDB entries)
  8. 2107572Domain d3wsvd1: 3wsv D:3-147 [262451]
    Other proteins in same PDB: d3wsva2, d3wsva3, d3wsvb2, d3wsvb3, d3wsvc2, d3wsvc3, d3wsvd2, d3wsvd3
    automated match to d3wsva1
    complexed with gol

Details for d3wsvd1

PDB Entry: 3wsv (more details), 2.38 Å

PDB Description: crystal structure of minor l-lactate dehydrogenase from enterococcus mundtii in the ligands-unbound form
PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3wsvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wsvd1 c.2.1.0 (D:3-147) automated matches {Enterococcus mundtii [TaxId: 53346]}
ktsrkvvivgtgfvgtsiayaminqgvanelvlidvnqekaegealdlldgmawgeknvs
vwsgtyeecqdanlviltagvnqkpgqtrldlvktnatitrqivkevmasgfdgifvvas
npvdiltyltwqesglpasrvvgtg

SCOPe Domain Coordinates for d3wsvd1:

Click to download the PDB-style file with coordinates for d3wsvd1.
(The format of our PDB-style files is described here.)

Timeline for d3wsvd1: