Lineage for d3wn5c1 (3wn5 C:1-83)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764414Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1764808Protein automated matches [190803] (2 species)
    not a true protein
  7. 1764809Species Human (Homo sapiens) [TaxId:9606] [188070] (27 PDB entries)
  8. 1764857Domain d3wn5c1: 3wn5 C:1-83 [262432]
    Other proteins in same PDB: d3wn5a1, d3wn5a2, d3wn5b1, d3wn5b2, d3wn5d1, d3wn5d2, d3wn5e1, d3wn5e2
    automated match to d1fnla1
    complexed with iod, nag

Details for d3wn5c1

PDB Entry: 3wn5 (more details), 2.78 Å

PDB Description: crystal structure of asymmetrically engineered fc variant in complex with fcgriiia
PDB Compounds: (C:) Low affinity immunoglobulin gamma Fc region receptor III-A

SCOPe Domain Sequences for d3wn5c1:

Sequence, based on SEQRES records: (download)

>d3wn5c1 b.1.1.4 (C:1-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlpkavvflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfidaatv
ddsgeyrcqtqlstlsdpvqlev

Sequence, based on observed residues (ATOM records): (download)

>d3wn5c1 b.1.1.4 (C:1-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlpkavvflepqwyrvlekdsvtlkcqgayspqstqwfhneslissqassyfidaatvdd
sgeyrcqtqlstlsdpvqlev

SCOPe Domain Coordinates for d3wn5c1:

Click to download the PDB-style file with coordinates for d3wn5c1.
(The format of our PDB-style files is described here.)

Timeline for d3wn5c1: