SCOPe 2.08: Domain d3wjaa2: 3wja A:280-579

Lineage for d3wjaa2 (3wja A:280-579)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)

8. Domain d3wjaa2: 3wja A:280-579 [262425]
   Other proteins in same PDB: d3wjaa1, d3wjab1
   automated match to d3wjab2

Details for d3wjaa2

PDB Entry: 3wja, 2.55 Å

PDB Description: the crystal structure of human cytosolic nadp(+)-dependent malic enzyme in apo form

PDB Compounds: (A:) NADP-dependent malic enzyme

SCOPe Domain Sequences for d3wjaa2:

Sequence; same for both SEQRES and ATOM records:

>d3wjaa2 c.2.1.0 (A:280-579) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqgtasvavagllaalritknklsdqtilfqgageaalgiahlivmalekeglpkekaik
kiwlvdskglivkgrasltqekekfaheheemknleaivqeikptaligvaaiggafseq
ilkdmaafnerpiifalsnptskaecsaeqcykitkgraifasgspfdpvtlpngqtlyp
gqgnnsyvfpgvalgvvacglrqitdniflttaeviaqqvsdkhleegrlypplntirdv
slkiaekivkdayqektatvypepqnkeafvrsqmystdydqilpdcyswpeevqkiqtk

Timeline for d3wjaa2:

• d3wjaa2 first appeared in SCOPe 2.05
  
• d3wjaa2 appears in SCOPe 2.07