Lineage for d3wgdc1 (3wgd C:62-170)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879614Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)
  8. 2879834Domain d3wgdc1: 3wgd C:62-170 [262399]
    Other proteins in same PDB: d3wgda2, d3wgdb2, d3wgdc2, d3wgdd2, d3wgde2, d3wgdf2, d3wgdg2, d3wgdh2, d3wgdi2
    automated match to d3wgea_
    complexed with gol, k, po4

Details for d3wgdc1

PDB Entry: 3wgd (more details), 2.5 Å

PDB Description: Crystal structure of ERp46 Trx1
PDB Compounds: (C:) Thioredoxin domain-containing protein 5

SCOPe Domain Sequences for d3wgdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wgdc1 c.47.1.0 (C:62-170) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skhlytadmfthgiqsaahfvmffapwcghcqrlqptwndlgdkynsmedakvyvakvdc
tahsdvcsaqgvrgyptlklfkpgqeavkyqgprdfqtlenwmlqtlne

SCOPe Domain Coordinates for d3wgdc1:

Click to download the PDB-style file with coordinates for d3wgdc1.
(The format of our PDB-style files is described here.)

Timeline for d3wgdc1: