SCOPe 2.08: Domain d3w88b1: 3w88 B:0-312

Lineage for d3w88b1 (3w88 B:0-312)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein Dihydroorotate dehydrogenase [51397] (8 species)

7. Species Trypanosoma cruzi [TaxId:353153] [254868] (49 PDB entries)

8. Domain d3w88b1: 3w88 B:0-312 [262353]
   Other proteins in same PDB: d3w88a2, d3w88b2
   automated match to d3w88a_
   complexed with cac, edo, fmn, gol, nco, peg, w88
   has additional subdomain(s) that are not in the common domain
   has additional insertions and/or extensions that are not grouped together

Details for d3w88b1

PDB Entry: 3w88, 1.4 Å

PDB Description: structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with sh-1-200

PDB Compounds: (B:) Dihydroorotate dehydrogenase (fumarate)

SCOPe Domain Sequences for d3w88b1:

Sequence; same for both SEQRES and ATOM records:

>d3w88b1 c.1.4.1 (B:0-312) Dihydroorotate dehydrogenase {Trypanosoma cruzi [TaxId: 353153]}
mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvktie

Timeline for d3w88b1:

• d3w88b1 first appeared in SCOPe 2.05, called d3w88b_
  
• d3w88b1 appears in SCOPe 2.07