Lineage for d3qd8e1 (3qd8 E:10-163)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1991631Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1991632Protein automated matches [190036] (39 species)
    not a true protein
  7. 1991947Species Mycobacterium tuberculosis [TaxId:419947] [255998] (2 PDB entries)
  8. 1991975Domain d3qd8e1: 3qd8 E:10-163 [262319]
    automated match to d3oj5a_

Details for d3qd8e1

PDB Entry: 3qd8 (more details), 3 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis BfrB
PDB Compounds: (E:) Probable bacterioferritin BfrB

SCOPe Domain Sequences for d3qd8e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qd8e1 a.25.1.0 (E:10-163) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
kfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhlldr
dlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqwfl
qeqieevalmatlvrvadraganlfelenfvare

SCOPe Domain Coordinates for d3qd8e1:

Click to download the PDB-style file with coordinates for d3qd8e1.
(The format of our PDB-style files is described here.)

Timeline for d3qd8e1: