Lineage for d3ot4e_ (3ot4 E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864173Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864174Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2864227Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2864228Protein automated matches [190499] (26 species)
    not a true protein
  7. 2864247Species Bordetella bronchiseptica [TaxId:518] [256004] (2 PDB entries)
  8. 2864260Domain d3ot4e_: 3ot4 E: [262315]
    automated match to d3uaod_

Details for d3ot4e_

PDB Entry: 3ot4 (more details), 2.4 Å

PDB Description: Structure and Catalytic Mechanism of Bordetella bronchiseptica nicF
PDB Compounds: (E:) Putative isochorismatase

SCOPe Domain Sequences for d3ot4e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ot4e_ c.33.1.0 (E:) automated matches {Bordetella bronchiseptica [TaxId: 518]}
lgsyerqgfgaalplkapygllivdfvngfadpaqfgggniaaaiettrtvlaaarergw
avahsrivyadddadgnifsikvpgmltlkehapasaivpqlapqageyvvrkstpsafy
gtmlaawlaqrgvqtllvagattsgcvrasvvdamsagfrplvlsdcvgdralgpheanl
fdmrqkyaavmthdealaktk

SCOPe Domain Coordinates for d3ot4e_:

Click to download the PDB-style file with coordinates for d3ot4e_.
(The format of our PDB-style files is described here.)

Timeline for d3ot4e_: