Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) |
Family f.23.12.0: automated matches [254198] (1 protein) not a true family |
Protein automated matches [254432] (4 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [260678] (8 PDB entries) |
Domain d3l75r1: 3l75 R:1-69 [262311] Other proteins in same PDB: d3l75a1, d3l75a2, d3l75b1, d3l75b2, d3l75c1, d3l75c2, d3l75d1, d3l75d2, d3l75e2, d3l75f_, d3l75g_, d3l75h_, d3l75j_, d3l75n1, d3l75n2, d3l75o1, d3l75o2, d3l75p1, d3l75p2, d3l75q1, d3l75q2, d3l75r2, d3l75s_, d3l75t_, d3l75u_, d3l75w_ automated match to d3l70e1 complexed with azi, bog, cdl, fes, fnm, hec, hem, pee, unl, uq |
PDB Entry: 3l75 (more details), 2.79 Å
SCOPe Domain Sequences for d3l75r1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l75r1 f.23.12.0 (R:1-69) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} vhndvtvpdfsayrredvmdattssqtssedrkgfsylvtatacvatayaaknvvtqfis slsasadvl
Timeline for d3l75r1:
View in 3D Domains from other chains: (mouse over for more information) d3l75a1, d3l75a2, d3l75b1, d3l75b2, d3l75c1, d3l75c2, d3l75d1, d3l75d2, d3l75e1, d3l75e2, d3l75f_, d3l75g_, d3l75h_, d3l75j_, d3l75n1, d3l75n2, d3l75o1, d3l75o2, d3l75p1, d3l75p2, d3l75q1, d3l75q2, d3l75s_, d3l75t_, d3l75u_, d3l75w_ |