![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (40 superfamilies) not a true fold |
![]() | Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) ![]() |
![]() | Family f.23.12.0: automated matches [254198] (1 protein) not a true family |
![]() | Protein automated matches [254432] (4 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [260678] (8 PDB entries) |
![]() | Domain d3l74e1: 3l74 E:1-69 [262305] Other proteins in same PDB: d3l74a1, d3l74a2, d3l74b1, d3l74b2, d3l74c1, d3l74c2, d3l74d1, d3l74d2, d3l74e2, d3l74f_, d3l74g_, d3l74h_, d3l74j_, d3l74n1, d3l74n2, d3l74o1, d3l74o2, d3l74p1, d3l74p2, d3l74q1, d3l74q2, d3l74r2, d3l74s_, d3l74t_, d3l74u_, d3l74w_ automated match to d3l70e1 complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq |
PDB Entry: 3l74 (more details), 2.76 Å
SCOPe Domain Sequences for d3l74e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l74e1 f.23.12.0 (E:1-69) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} vhndvtvpdfsayrredvmdattssqtssedrkgfsylvtatacvatayaaknvvtqfis slsasadvl
Timeline for d3l74e1:
![]() Domains from other chains: (mouse over for more information) d3l74a1, d3l74a2, d3l74b1, d3l74b2, d3l74c1, d3l74c2, d3l74d1, d3l74d2, d3l74f_, d3l74g_, d3l74h_, d3l74j_, d3l74n1, d3l74n2, d3l74o1, d3l74o2, d3l74p1, d3l74p2, d3l74q1, d3l74q2, d3l74r1, d3l74r2, d3l74s_, d3l74t_, d3l74u_, d3l74w_ |