SCOPe 2.05: Domain d3l73r1: 3l73 R:1-69

Lineage for d3l73r1 (3l73 R:1-69)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
   not a true fold

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families)

5. Family f.23.12.0: automated matches [254198] (1 protein)
   not a true family

6. Protein automated matches [254432] (4 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [260678] (8 PDB entries)

8. Domain d3l73r1: 3l73 R:1-69 [262303]
   Other proteins in same PDB: d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c1, d3l73c2, d3l73d1, d3l73d2, d3l73e2, d3l73f_, d3l73g_, d3l73h_, d3l73j_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73p1, d3l73p2, d3l73q1, d3l73q2, d3l73r2, d3l73s_, d3l73t_, d3l73u_, d3l73w_
   automated match to d3l70e1
   complexed with bog, cdl, fes, gol, hec, hem, jzz, pee, uq

Details for d3l73r1

PDB Entry: 3l73, 3.04 Å

PDB Description: cytochrome bc1 complex from chicken with triazolone inhibitor

PDB Compounds: (R:) cytochrome b-c1 complex subunit 5, rieske ironsulfur protein, mitochondrial

SCOPe Domain Sequences for d3l73r1:

Sequence; same for both SEQRES and ATOM records:

>d3l73r1 f.23.12.0 (R:1-69) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
vhndvtvpdfsayrredvmdattssqtssedrkgfsylvtatacvatayaaknvvtqfis
slsasadvl

Timeline for d3l73r1:

• d3l73r1 is new in SCOPe 2.05-stable
  
• d3l73r1 appears in SCOPe 2.06
  
• d3l73r1 appears in the current release, SCOPe 2.08