Lineage for d3l73e2 (3l73 E:70-196)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391958Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2391959Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2391960Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 2392045Protein automated matches [190874] (7 species)
    not a true protein
  7. 2392050Species Chicken (Gallus gallus) [TaxId:9031] [260680] (8 PDB entries)
  8. 2392061Domain d3l73e2: 3l73 E:70-196 [262302]
    Other proteins in same PDB: d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c1, d3l73c2, d3l73d1, d3l73d2, d3l73e1, d3l73f_, d3l73g_, d3l73h_, d3l73j_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73p1, d3l73p2, d3l73q1, d3l73q2, d3l73r1, d3l73s_, d3l73t_, d3l73u_, d3l73w_
    automated match to d3l70e2
    complexed with bog, cdl, fes, gol, hec, hem, jzz, pee, uq

Details for d3l73e2

PDB Entry: 3l73 (more details), 3.04 Å

PDB Description: cytochrome bc1 complex from chicken with triazolone inhibitor
PDB Compounds: (E:) cytochrome b-c1 complex subunit 5, rieske ironsulfur protein, mitochondrial

SCOPe Domain Sequences for d3l73e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l73e2 b.33.1.1 (E:70-196) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
alskieiklsdipegknvafkwrgkplfvrhrtqaeinqeaevdvsklrdpqhdldrvkk
pewvilvgvcthlgcvpiansgdfggyycpchgshydasgrirkgpapynlevptyqfvg
ddlvvvg

SCOPe Domain Coordinates for d3l73e2:

Click to download the PDB-style file with coordinates for d3l73e2.
(The format of our PDB-style files is described here.)

Timeline for d3l73e2: