SCOPe 2.07: Domain d3l72r2: 3l72 R:70-196

Lineage for d3l72r2 (3l72 R:70-196)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)

6. Protein automated matches [190874] (7 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [260680] (8 PDB entries)

8. Domain d3l72r2: 3l72 R:70-196 [262300]
   Other proteins in same PDB: d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c1, d3l72c2, d3l72d1, d3l72d2, d3l72e1, d3l72f_, d3l72g_, d3l72h_, d3l72j_, d3l72n1, d3l72n2, d3l72o1, d3l72o2, d3l72p1, d3l72p2, d3l72q1, d3l72q2, d3l72r1, d3l72s_, d3l72t_, d3l72u_, d3l72w_
   automated match to d3l70e2
   complexed with bog, cdl, fes, gol, hec, hem, ikr, pee, uq

Details for d3l72r2

PDB Entry: 3l72, 3.06 Å

PDB Description: chicken cytochrome bc1 complex with kresoxim-i-dimethyl bound

PDB Compounds: (R:) cytochrome b-c1 complex subunit 5, rieske ironsulfur protein, mitochondrial

SCOPe Domain Sequences for d3l72r2:

Sequence; same for both SEQRES and ATOM records:

>d3l72r2 b.33.1.1 (R:70-196) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
alskieiklsdipegknvafkwrgkplfvrhrtqaeinqeaevdvsklrdpqhdldrvkk
pewvilvgvcthlgcvpiansgdfggyycpchgshydasgrirkgpapynlevptyqfvg
ddlvvvg

Timeline for d3l72r2:

• d3l72r2 first appeared in SCOPe 2.05
  
• d3l72r2 appears in SCOPe 2.06
  
• d3l72r2 appears in the current release, SCOPe 2.08